SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357394 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357394
Domain Number 1 Region: 27-155
Classification Level Classification E-value
Superfamily Cupredoxins 4.26e-43
Family Ephrin ectodomain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357394   Gene: ENSG00000243364   Transcript: ENST00000368409
Sequence length 201
Comment pep:known chromosome:GRCh38:1:155063731:155069553:1 gene:ENSG00000243364 transcript:ENST00000368409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
Download sequence
Identical sequences A0A2J8VG63 H2Q065 P52798
gi|4885197|ref|NP_005218.1| NP_005218.1.87134 NP_005218.1.92137 XP_001153095.1.37143 XP_003817143.1.60992 9598.ENSPTRP00000002365 ENSPTRP00000002365 ENSPTRP00000002365 ENSP00000357394 ENSP00000357394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]