SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357919 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357919
Domain Number 1 Region: 165-251
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.41e-22
Family D-aminoacid oxidase-like 0.0005
Further Details:      
 
Domain Number 2 Region: 29-178,239-296
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.12e-21
Family D-aminoacid oxidase, N-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357919   Gene: ENSG00000203797   Transcript: ENST00000368923
Sequence length 310
Comment pep:known chromosome:GRCh38:6:110391771:110415562:-1 gene:ENSG00000203797 transcript:ENST00000368923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVT
IISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLV
SGIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWV
EHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNI
REKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHA
LRTPIPKSNL
Download sequence
Identical sequences NP_004023.2.87134 NP_004023.2.92137 ENSP00000357919 gi|40217827|ref|NP_004023.2| ENSP00000357919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]