SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357920 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357920
Domain Number 1 Region: 29-237,298-355
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.47e-27
Family D-aminoacid oxidase, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 224-310
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.76e-22
Family D-aminoacid oxidase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357920   Gene: ENSG00000203797   Transcript: ENST00000368924
Sequence length 369
Comment pep:known chromosome:GRCh38:6:110391771:110415562:-1 gene:ENSG00000203797 transcript:ENST00000368924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVT
IISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLV
SGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEK
RIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVE
HFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIR
EKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHAL
RTPIPKSNL
Download sequence
Identical sequences 9606.ENSP00000357920 ENSP00000357920 NP_003640.2.87134 NP_003640.2.92137 gi|40217815|ref|NP_003640.2| ENSP00000357919 ENSP00000357920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]