SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358050 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358050
Domain Number 1 Region: 202-469
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.06e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000542
Further Details:      
 
Domain Number 2 Region: 471-579
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.38e-26
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 123-211
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.01e-17
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0059
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000523
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358050   Gene: ENSG00000143374   Transcript: ENST00000369054
Sequence length 588
Comment pep:known chromosome:GRCh38:1:150487414:150507258:1 gene:ENSG00000143374 transcript:ENST00000369054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAARPFRRLEASRDQLRQLFKAEYAHRGFSEVKTPTLFSTKLWEQSGHWEH
YQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRL
ADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSF
RLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGR
PHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLW
LSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFV
VGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
Download sequence
Identical sequences A0A2I3T918
ENSP00000358050 NP_001258825.1.87134 NP_001258825.1.92137 ENSP00000358050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]