SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358141 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358141
Domain Number 1 Region: 154-381,425-474
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-46
Family LacY-like proton/sugar symporter 0.068
Further Details:      
 
Domain Number 2 Region: 498-578
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000000942
Family Pentapeptide repeats 0.0066
Further Details:      
 
Domain Number 3 Region: 590-682
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000641
Family Glycerol-3-phosphate transporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358141   Gene: ENSG00000159164   Transcript: ENST00000369145
Sequence length 682
Comment pep:putative chromosome:GRCh38:1:149905472:149917841:-1 gene:ENSG00000159164 transcript:ENST00000369145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA
PSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
ASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKR
Download sequence
Identical sequences ENSP00000358141 ENSP00000462467 ENSP00000358141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]