SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358310 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358310
Domain Number 1 Region: 23-142,334-644
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-70
Family Integrin alpha N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 162-357
Classification Level Classification E-value
Superfamily vWA-like 4.15e-45
Family Integrin A (or I) domain 0.0000043
Further Details:      
 
Domain Number 3 Region: 644-791
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-26
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 4 Region: 792-929
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-23
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 5 Region: 964-1093
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000126
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358310   Gene: ENSG00000143127   Transcript: ENST00000369304
Sequence length 1167
Comment pep:known chromosome:GRCh38:1:145891208:145910189:-1 gene:ENSG00000143127 transcript:ENST00000369304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA
AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ
RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT
SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
VFCLWKLGFFAHKKIPEEEKREEKLEQ
Download sequence
Identical sequences O75578
ENSP00000358310 ENSP00000358310 ENSP00000462258 NP_003628.2.87134 NP_003628.2.92137 gi|38569398|ref|NP_003628.2| ENSP00000358310 ENSP00000462898 NYSGRC-38569398 9606.ENSP00000358310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]