SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358731 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358731
Domain Number 1 Region: 92-174
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000021
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358731   Gene: ENSG00000121933   Transcript: ENST00000369717
Sequence length 266
Comment pep:known chromosome:GRCh38:1:111483348:111563962:-1 gene:ENSG00000121933 transcript:ENST00000369717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM
Download sequence
Identical sequences P0DMS9
ENSP00000358731 ENSP00000358731 gi|130978672|ref|NP_001075445.1| NP_001075445.1.87134 NP_001075445.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]