SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359303 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359303
Domain Number 1 Region: 44-139
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.7e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359303   Gene: ENSG00000117500   Transcript: ENST00000370280
Sequence length 162
Comment pep:known chromosome:GRCh38:1:93156040:93180261:-1 gene:ENSG00000117500 transcript:ENST00000370280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEI
EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVI
FFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILVSMVF
Download sequence
Identical sequences B1AKT3
ENSP00000359303 ENSP00000359303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]