SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359305 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359305
Domain Number 1 Region: 44-139
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.18e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359305   Gene: ENSG00000117500   Transcript: ENST00000370282
Sequence length 229
Comment pep:known chromosome:GRCh38:1:93149742:93180728:-1 gene:ENSG00000117500 transcript:ENST00000370282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEI
EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVI
FFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAF
EARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSRT
Download sequence
Identical sequences Q9Y3A6
ENSP00000359305 ENSP00000359303 ENSP00000359305 gi|282165814|ref|NP_057124.3| NP_057124.3.87134 NP_057124.3.92137 9606.ENSP00000359305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]