SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359346 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000359346
Domain Number - Region: 57-105
Classification Level Classification E-value
Superfamily Cupredoxins 0.0335
Family Multidomain cupredoxins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359346   Gene: ENSG00000166136   Transcript: ENST00000370322
Sequence length 155
Comment pep:known chromosome:GRCh38:10:100523743:100530000:-1 gene:ENSG00000166136 transcript:ENST00000370322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYS
WDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYP
VYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Download sequence
Identical sequences NP_001271297.1.87134 NP_001271297.1.92137 ENSP00000359346 ENSP00000359346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]