SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359446
Domain Number 1 Region: 18-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.42e-80
Family Pancreatic carboxypeptidases 0.000000883
Further Details:      
 
Domain Number 2 Region: 341-423
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.08e-20
Family Carboxypeptidase regulatory domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359446   Gene: ENSG00000120054   Transcript: ENST00000370418
Sequence length 458
Comment pep:known chromosome:GRCh38:10:100042193:100081877:-1 gene:ENSG00000120054 transcript:ENST00000370418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQD
TRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRT
ASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVIS
VSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Download sequence
Identical sequences P15169
ENSP00000359446 NP_001299.1.87134 NP_001299.1.92137 gi|4503011|ref|NP_001299.1| ENSP00000359446 ENSP00000359446 9606.ENSP00000359446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]