SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359607 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359607
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.51e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359607   Gene: ENSG00000119943   Transcript: ENST00000370575
Sequence length 581
Comment pep:known chromosome:GRCh38:10:98383565:98415184:-1 gene:ENSG00000119943 transcript:ENST00000370575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFERRHVIGGAAVTEEIIPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPYSFT
PMLEEGAGSKVPRCLLLGTDMAENQKQIAQFSQKDAQVFPKYEEFMHRLALAIDPLLDAA
PVDMAAFQHGSLLQRMRSLSTLKPLLKAGRILGAQLPRYYEVLTAPITKVLDQWFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATT
HGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEE
FLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAF
EDAMDGLPSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYMPYTLAGGKAWDEQERDAYA
DRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHS
GYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM
Download sequence
Identical sequences Q8N2H3
ENSP00000359607 9606.ENSP00000359607 ENSP00000359607 ENSP00000359607 gi|229577391|ref|NP_116098.2| NP_116098.2.87134 NP_116098.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]