SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359740 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000359740
Domain Number - Region: 363-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000627
Family HkH motif-containing C2H2 finger 0.07
Further Details:      
 
Domain Number - Region: 305-330,527-543
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00544
Family Cytochrome c3-like 0.073
Further Details:      
 
Domain Number - Region: 207-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00878
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number - Region: 636-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0579
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359740   Gene: ENSG00000112200   Transcript: ENST00000370706
Sequence length 1061
Comment pep:known chromosome:GRCh38:6:57090010:57170307:1 gene:ENSG00000112200 transcript:ENST00000370706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSY
TDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEF
IRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEF
DNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDG
HNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKSITQVAEKFIL
RGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRF
PSEDAVEKHVFSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKEL
TRKDTIMAHVTEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIETLYRHCQDEHD
NEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTEDDFPVIETSNQL
TCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNTHIHQVHKEKS
DEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICM
HAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISD
TTKECDSDDNMGAKNTSIGEEFISTEDVELEEAIRRSLEEM
Download sequence
Identical sequences Q9Y4E5
NP_001026794.1.87134 NP_001026794.1.92137 gi|72255571|ref|NP_001026794.1| ENSP00000359740 ENSP00000359740 9606.ENSP00000359740 NYSGRC-72255571 ENSP00000359740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]