SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360452 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000360452
Domain Number - Region: 22-105
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0575
Family Rhomboid-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360452   Gene: ENSG00000058799   Transcript: ENST00000371399
Sequence length 123
Comment pep:known chromosome:GRCh38:1:53851733:53889779:-1 gene:ENSG00000058799 transcript:ENST00000371399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGSLLA
MTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTVAAA
KSS
Download sequence
Identical sequences A0A2J8NI41
ENSP00000360452 ENSP00000360452 XP_003949474.1.37143 XP_016774258.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]