SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360933 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360933
Domain Number 1 Region: 5-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.2e-38
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360933   Gene: ENSG00000123453   Transcript: ENST00000371867
Sequence length 283
Comment pep:known chromosome:GRCh38:9:133718322:133734043:-1 gene:ENSG00000123453 transcript:ENST00000371867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEETGLHTGWIQ
NGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDG
TMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSIQTPCVVN
CAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVG
GYEANPIFWEEAVKYRPRAAGGLCLKTSTEKVCAVWSDDLRRA
Download sequence
Identical sequences Q5SYU9
ENSP00000360933 ENSP00000360933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]