SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361761 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361761
Domain Number 1 Region: 76-122
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000366
Family Elafin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 29-73
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000144
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361761   Gene: ENSG00000101443   Transcript: ENST00000372676
Sequence length 124
Comment pep:known chromosome:GRCh38:20:45469706:45481532:1 gene:ENSG00000101443 transcript:ENST00000372676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLK
CCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV
TPNF
Download sequence
Identical sequences G3QNH9 H2QKF8 Q14508
gi|56699495|ref|NP_006094.3| ENSP00000217425 ENSP00000361761 ENSPTRP00000023271 ENSGGOP00000004095 ENSGGOP00000004095 ENSP00000361761 GO.80354 9598.ENSPTRP00000023271 9606.ENSP00000361761 NP_006094.3.87134 NP_006094.3.92137 XP_004062302.1.27298 XP_008949604.1.60992 XP_009435581.1.37143 ENSPTRP00000023271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]