SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361888 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361888
Domain Number 1 Region: 42-239
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.11e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000103
Further Details:      
 
Domain Number 2 Region: 318-474
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 6.41e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361888   Gene: ENSG00000131236   Transcript: ENST00000372802
Sequence length 474
Comment pep:known chromosome:GRCh38:1:40040240:40072515:1 gene:ENSG00000131236 transcript:ENST00000372802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKGAAPYVQAFDSLLAGPVAEYLKI
SKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREK
NRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVD
WVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPP
VSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFS
APKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTL
QIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLS
KNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences ENSP00000344832 ENSP00000361884 ENSP00000361888 XP_011538813.1.92137 XP_011538814.1.92137 XP_011538815.1.92137 XP_011538816.1.92137 XP_011538817.1.92137 XP_016855562.1.92137 ENSP00000344832 ENSP00000361884 ENSP00000361888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]