SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361997 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361997
Domain Number 1 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361997   Gene: ENSG00000124120   Transcript: ENST00000372906
Sequence length 154
Comment pep:putative chromosome:GRCh38:20:44475904:44489836:1 gene:ENSG00000124120 transcript:ENST00000372906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHVVCIRPVLPPWV
Download sequence
Identical sequences A0A2I2Z8X0 A0A2I3RBZ6 A0A2J8XVY6 A6PVK2 M3ZC44
ENSP00000361997 ENSP00000361997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]