SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362081 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362081
Domain Number 1 Region: 68-264
Classification Level Classification E-value
Superfamily Rhomboid-like 3.27e-34
Family Rhomboid-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362081   Gene: ENSG00000158315   Transcript: ENST00000372990
Sequence length 303
Comment pep:known chromosome:GRCh38:1:38885807:38941784:-1 gene:ENSG00000158315 transcript:ENST00000372990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRG
TYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEA
WRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPL
RYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFALYRRFFVPE
DGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLFAVFFNIFLS
PAN
Download sequence
Identical sequences G3R248 H2N7W6 H2PYQ6 Q9NX52
gi|54144654|ref|NP_060291.2| ENSPPYP00000001748 ENSP00000289248 ENSP00000362081 NP_060291.2.87134 NP_060291.2.92137 XP_009250532.1.23681 9598.ENSPTRP00000000988 9600.ENSPPYP00000001748 9606.ENSP00000289248 ENSP00000289248 ENSP00000362081 ENSPPYP00000001748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]