SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363972 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000363972
Domain Number - Region: 187-209
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0144
Family Cytochrome c3-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363972   Gene: ENSG00000126970   Transcript: ENST00000374839
Sequence length 224
Comment pep:known chromosome:GRCh38:X:64916381:64976484:-1 gene:ENSG00000126970 transcript:ENST00000374839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRL
PDLCEEEEKLSLDYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFR
QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE
Download sequence
Identical sequences A0A0D9RHR0 A0A1S3GLJ0 A0A1U7QL27 A0A1U7UL73 A0A250YCY0 A0A2I2UTC5 A0A2I3GEZ6 A0A2K5DUV8 A0A2K5IQT6 A0A2K5MLD6 A0A2K5Q858 A0A2K5YE81 A0A2K6E8M9 A0A2K6F508 A0A2K6RKD6 A0A2K6SHF0 B1WC48 F6QJQ6 F7CYZ8 G1T5B2 G3ICB7 G5C7V9 G7NRR9 G7Q2W6 H2PVU8 H2QYQ0 I3MUZ0 Q68FG0 Q9NQZ6
ENSPPYP00000022850 ENSMUSP00000041236 11005 GO.38769 ENSCJAP00000032864 ENSRNOP00000007486 ENSRNOP00000007486 ENSSTOP00000015935 ENSFCAP00000018946 10090.ENSMUSP00000041236 10116.ENSRNOP00000007486 9598.ENSPTRP00000037748 9600.ENSPPYP00000022850 9606.ENSP00000363972 9615.ENSCAFP00000024353 9796.ENSECAP00000015709 9986.ENSOCUP00000011523 ENSP00000338650 ENSP00000363972 ENSCJAP00000032872 ENSMUSP00000041236 ENSP00000363972 ENSPPYP00000022850 ENSOCUP00000011523 ENSPTRP00000037748 ENSECAP00000015709 gi|8923720|ref|NP_061154.1| ENSPTRP00000037748 ENSMUSP00000041236 HGL_H00000363972 ENSECAP00000015709 ENSNLEP00000000451 ENSNLEP00000000451 ENSSTOP00000015935 NP_001003916.1.92730 NP_001119846.1.100692 NP_001119846.1.4139 NP_001248665.1.72884 NP_061154.1.87134 NP_061154.1.92137 XP_001504910.1.31192 XP_002762991.2.60252 XP_002831780.1.23681 XP_003272697.1.23891 XP_003512563.1.69978 XP_003816968.1.60992 XP_003940998.1.74449 XP_004000618.1.62641 XP_004409558.1.74151 XP_004439966.1.5094 XP_004595254.1.84141 XP_004644867.1.9945 XP_004872313.1.39548 XP_005081202.1.91757 XP_005335268.1.77405 XP_005371582.1.66349 XP_005401619.1.28644 XP_005593839.1.63531 XP_006082904.1.53796 XP_006765746.1.95426 XP_006981249.1.50099 XP_007606511.1.28591 XP_007956914.1.48129 XP_007990099.1.81039 XP_008066606.1.4292 XP_008270938.1.1745 XP_008590503.1.73410 XP_008842575.1.79516 XP_010365834.1.97406 XP_010630508.1.5607 XP_011731173.1.29376 XP_011782838.1.43180 XP_011831900.1.47321 XP_011916325.1.92194 XP_012316290.1.9421 XP_012498488.1.63892 XP_012605471.1.48125 XP_012889748.1.60039 XP_014438235.1.99106 XP_014688444.1.49734 XP_015357153.1.40921 XP_016065650.1.3490 XP_017367638.1.71028 XP_017510668.1.32401 XP_018875272.1.27298 XP_019294443.1.44245 XP_020013144.1.5219 XP_021043652.1.100879 XP_521094.2.37143 ENSOCUP00000011523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]