SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000364042 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364042
Domain Number 1 Region: 31-432
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.4e-96
Family Integrin alpha N-terminal domain 0.000000000000356
Further Details:      
 
Domain Number 2 Region: 733-961
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-68
Family Integrin domains 0.00000000137
Further Details:      
 
Domain Number 3 Region: 433-592
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-46
Family Integrin domains 0.0000000284
Further Details:      
 
Domain Number 4 Region: 593-725
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-36
Family Integrin domains 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364042   Gene: ENSG00000138448   Transcript: ENST00000374907
Sequence length 1012
Comment pep:known chromosome:GRCh38:2:186590080:186680897:1 gene:ENSG00000138448 transcript:ENST00000374907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSRQLISD
QVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRA
ARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSD
GKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGG
EDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGA
FGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGV
LPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDES
EFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKL
EVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARL
SCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKV
SPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNG
PSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDT
VAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTE
TFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWV
IILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Download sequence
Identical sequences ENSP00000364042 ENSP00000364042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]