SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000364467 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364467
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 8.31e-48
Family C-type lysozyme 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364467   Gene: ENSG00000151033   Transcript: ENST00000375318
Sequence length 194
Comment pep:known chromosome:GRCh38:10:30611779:30629762:-1 gene:ENSG00000151033 transcript:ENST00000375318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCE
GRDLSDWKKDCEVS
Download sequence
Identical sequences A0A080YUZ9
NP_898881.2.87134 NP_898881.2.92137 9606.ENSP00000364467 gi|73088987|ref|NP_898881.2| ENSP00000364467 ENSP00000364467 ENSP00000364467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]