SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000364602 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364602
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Cupredoxins 1.7e-38
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364602   Gene: ENSG00000159339   Transcript: ENST00000375453
Sequence length 127
Comment pep:known chromosome:GRCh38:1:17308195:17334796:1 gene:ENSG00000159339 transcript:ENST00000375453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK
KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVDGVSPCH
PGWSAMA
Download sequence
Identical sequences B1AQ67
ENSP00000364602 ENSP00000364602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]