SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365633 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365633
Domain Number 1 Region: 325-681
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-111
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 140-320
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-48
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 38-151
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000285
Family GAF domain 0.000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365633   Gene: ENSG00000186642   Transcript: ENST00000376450
Sequence length 685
Comment pep:novel chromosome:GRCh38:11:72576142:72642431:-1 gene:ENSG00000186642 transcript:ENST00000376450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVLHHILIAVVQFLRRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAV
KEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVRFTDEDEHVIQHCFHYTSTV
LTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLD
QNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTG
FRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKK
VNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTS
MAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLE
LTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIA
ILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHH
RLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIP
ELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFL
DEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences A0A2I3SKH6
ENSP00000365633 ENSP00000365633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]