SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366523 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366523
Domain Number 1 Region: 21-136,163-201
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000682
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366523   Gene: ENSG00000089101   Transcript: ENST00000377308
Sequence length 320
Comment pep:known chromosome:GRCh38:20:20225461:20360698:1 gene:ENSG00000089101 transcript:ENST00000377308 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSYALNHTNRKLTLEPKITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLP
GKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPY
DHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALI
WIRNNSITTEGNIIVYGNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVES
AVADALGAAGVTMYRDAILAQWNDGLHPDPIYSASFTTPTKPFRLQCSGAFFLGLTIICI
LPSLPFQLPWRYKWHSLIMV
Download sequence
Identical sequences ENSP00000366523 ENSP00000366523 ENSP00000366524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]