SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368061 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000368061
Domain Number - Region: 363-380,527-577
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0628
Family Cytochrome c3-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368061   Gene: ENSG00000102445   Transcript: ENST00000378784
Sequence length 595
Comment pep:known chromosome:GRCh38:13:46342964:46387233:-1 gene:ENSG00000102445 transcript:ENST00000378784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSNHYFLLCVNLPLREIHTPGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSF
SLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRT
ISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGS
DQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFVI
LELGDFNDITETCSCSCSSSKSVTYEPDFNSAELLAKELYRVFQKCWILSVVNSQLAGSL
SAAGSIVVNEECVRKDFESSMNVVQEIKFKSRIRGTEDWAPPRFQIIFNIHPPLKRDLVV
AAQNFFCAGCGTPVEPKFVKRLRYCEYLGKYFCDCCHSYAESCIPARILMMWDFKKYYVS
NFSKQLLDSIWHQPIFNLLSIGQSLYAKAKELDRVKEIQEQLFHIKKLLKTCRFANSALK
EFEQVPGHLTDELHLFSLEDLVRIKKGLLAPLLKDILKASLAHVAGCELCQGKGFICEFC
QNTTVIFPFQTATCRRCSACRACFHKQCFQSSECPRCARITARRKLLESVASAAT
Download sequence
Identical sequences ENSP00000368061 NP_001273692.1.87134 NP_001273692.1.92137 ENSP00000368061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]