SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368570 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000368570
Domain Number - Region: 92-124
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00282
Family TNF receptor-like 0.006
Further Details:      
 
Domain Number - Region: 130-153
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00647
Family TNF receptor-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368570   Gene: ENSG00000186891   Transcript: ENST00000379268
Sequence length 241
Comment pep:known chromosome:GRCh38:1:1203511:1206691:-1 gene:ENSG00000186891 transcript:ENST00000379268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
V
Download sequence
Identical sequences Q9Y5U5
NP_004186.1.87134 NP_004186.1.92137 ENSP00000368570 ENSP00000368570 gi|4759246|ref|NP_004186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]