SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368935 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368935
Domain Number 1 Region: 15-284
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.88e-60
Family Protein prenyltransferases 0.0000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368935   Gene: ENSG00000164219   Transcript: ENST00000379615
Sequence length 300
Comment pep:known chromosome:GRCh38:5:115212402:115262851:-1 gene:ENSG00000164219 transcript:ENST00000379615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAITYIRRSMLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHP
DALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQSWKTKDSKQCSENVHIST
Download sequence
Identical sequences A0A2I2Z505 A0A2I3HQ30 A0A2I3SGC6 A0A2J8XEJ5 A0A2K5NZ34 A0A2K5WTI3 A0A2K5XHP6 A0A2K6CC99 A0A2K6MDH4 F7ALB7
XP_003259899.1.23891 XP_011826439.1.47321 ENSP00000368935 ENSP00000368935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]