SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369312 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369312
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000053
Family Complement control module/SCR domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369312   Gene: ENSG00000134470   Transcript: ENST00000379977
Sequence length 267
Comment pep:known chromosome:GRCh38:10:5952371:5977590:-1 gene:ENSG00000134470 transcript:ENST00000379977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL
Download sequence
Identical sequences Q13261
9606.ENSP00000369312 NP_002180.1.87134 NP_002180.1.92137 ENSP00000369312 gi|4504649|ref|NP_002180.1| ENSP00000369312 ENSP00000369312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]