SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369670 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369670
Domain Number 1 Region: 112-371
Classification Level Classification E-value
Superfamily L domain-like 1.19e-47
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 387-690
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.38e-41
Family Rhodopsin-like 0.00066
Further Details:      
 
Domain Number 3 Region: 41-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369670   Gene: ENSG00000133105   Transcript: ENST00000380314
Sequence length 730
Comment pep:known chromosome:GRCh38:13:31739542:31802872:1 gene:ENSG00000133105 transcript:ENST00000380314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLP
RAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKET
ELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA
FFGLCNLQILYLNHNCITTLRPGIFKDLHQLTWLILDDNPITRISQRLFTGLNSLFFLSM
VNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLTVLDLSSNTITELSPHL
FKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDLERIEIPNINTRMFQPMKNLSHIYF
KNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRIFVWVIAFITCFGNLFVIGMRSFIK
AENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYRGQYQKYALLWMESVQCRLMGFLAML
STEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVIPFWNKDYFG
NFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYITMFCSIQKTALQTT
EVRNCFGREVAVANRFFFIVFSDAICWIPVFVVKILSLFRVEIPDTMTSWIVIFFLPVNS
ALNPILYTLTTNFFKDKLKQLLHKHQRKSIFKIKKKSLSTSIVWIEDSSSLKLGVLNKIT
LGDSIMKPVS
Download sequence
Identical sequences gi|260593673|ref|NP_001159530.1| NP_001159530.1.87134 NP_001159530.1.92137 ENSP00000369670 ENSP00000369670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]