SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369860 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369860
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-39
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 319-457
Classification Level Classification E-value
Superfamily PapD-like 1.44e-37
Family MSP-like 0.000000217
Further Details:      
 
Domain Number 3 Region: 35-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000288
Family CRAL/TRIO N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369860   Gene: ENSG00000130150   Transcript: ENST00000380492
Sequence length 518
Comment pep:known chromosome:GRCh38:X:14873441:14922327:1 gene:ENSG00000130150 transcript:ENST00000380492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE
TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK
TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Download sequence
Identical sequences Q8NHP6
ENSP00000369860 ENSP00000369860 ENSP00000369860 NP_689794.1.87134 NP_689794.1.92137 9606.ENSP00000369860 gi|22749197|ref|NP_689794.1| GO.34885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]