SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369974 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369974
Domain Number 1 Region: 154-265
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 7.59e-31
Family Elongation factor TFIIS domain 2 0.0056
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.96e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0041
Further Details:      
 
Domain Number 3 Region: 287-345
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000113
Family Transcriptional factor domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369974   Gene: ENSG00000176896   Transcript: ENST00000380600
Sequence length 351
Comment pep:known chromosome:GRCh38:X:13655295:13665409:1 gene:ENSG00000176896 transcript:ENST00000380600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKNQIAARASLIEQLMSKRNFEDLGNHLTELETIYVTKEHLQETDVVRAVYRVLKNCP
SVALKKKAKCLLSKWKAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSS
NSLSSQDVAKLSEMIVPENRAIQLKPKEEHFGDGDPESTGKRSSELLDPTTPMRTKCIEL
LYAALTSSSTDQPKADLWQNFAREIEEHVFTLYSKNIKKYKTCIRSKVANLKNPRNSHLQ
QNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTNKIKCRRC
EKYNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVICNECGEQWYHSKWVCW
Download sequence
Identical sequences Q8N8B7
ENSP00000369974 hsi002021490.1 NP_001284492.1.87134 NP_001284492.1.92137 NP_001284493.1.87134 NP_001284493.1.92137 XP_016884806.1.92137 XP_016884807.1.92137 XP_016884808.1.92137 ENSP00000369974 ENSP00000438952 ENSP00000440038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]