SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000370462 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370462
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.28e-36
Family Phosphofructokinase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370462   Gene: ENSG00000067057   Transcript: ENST00000381072
Sequence length 202
Comment pep:putative chromosome:GRCh38:10:3129007:3136793:1 gene:ENSG00000067057 transcript:ENST00000381072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCS
ENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLK
EARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILA
KYKASYDVSDSGQLEHVQPWSV
Download sequence
Identical sequences B1APP8
ENSP00000370462 ENSP00000370462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]