SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371033 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371033
Domain Number 1 Region: 43-249
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 3.79e-57
Family Nicotinic receptor ligand binding domain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 250-445
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.57e-53
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371033   Gene: ENSG00000151834   Transcript: ENST00000381620
Sequence length 451
Comment pep:known chromosome:GRCh38:4:46249343:46389928:-1 gene:ENSG00000151834 transcript:ENST00000381620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Download sequence
Identical sequences A0A024R9X6 G3QVC6 H2QPE5 P47869
gi|167000751|ref|NP_000798.2| gi|167000817|ref|NP_001107647.1| ENSGGOP00000006690 NP_000798.2.87134 NP_000798.2.92137 NP_001107647.1.87134 NP_001107647.1.92137 XP_003310463.1.37143 XP_003816076.1.60992 XP_004038680.1.27298 XP_016863471.1.92137 XP_016863472.1.92137 ENSGGOP00000006690 ENSPTRP00000027574 ENSPTRP00000027574 9598.ENSPTRP00000027574 9606.ENSP00000348897 ENSP00000348897 ENSP00000371033 ENSP00000421300 ENSP00000421828 ENSP00000348897 ENSP00000371033 ENSP00000421300 ENSP00000421828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]