SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000372530 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372530
Domain Number 1 Region: 31-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000746
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372530   Gene: ENSG00000134779   Transcript: ENST00000383056
Sequence length 257
Comment pep:known chromosome:GRCh38:18:36796072:36828986:-1 gene:ENSG00000134779 transcript:ENST00000383056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSG
KPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFS
MYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPSGPS
TSSTSKSSSGSGNPTRK
Download sequence
Identical sequences A0A2I3RPE5
NP_001258879.1.87134 NP_001258879.1.92137 XP_003830265.1.60992 ENSP00000372530 ENSP00000372530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]