SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000372751 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372751
Domain Number 1 Region: 1579-1821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 551-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000012
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 475-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 513-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 5 Region: 277-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 589-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 927-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000141
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 768-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 359-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000455
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 158-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1047-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 678-810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000173
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 14 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000182
Family EGF-type module 0.028
Further Details:      
 
Domain Number 15 Region: 1253-1284
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 16 Region: 898-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 809-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000182
Family EGF-type module 0.021
Further Details:      
 
Domain Number 19 Region: 31-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000496
Family EGF-type module 0.025
Further Details:      
 
Domain Number 20 Region: 841-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000649
Family EGF-type module 0.014
Further Details:      
 
Domain Number 21 Region: 66-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1216-1246
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 23 Region: 120-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000183
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000372751
Domain Number - Region: 1175-1204
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1134-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372751   Gene: ENSG00000206312   Transcript: ENST00000383264
Sequence length 2003
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:32152449:32181676:-1 gene:ENSG00000206312 transcript:ENST00000383264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTVYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences A0A140T8Y6
9606.ENSP00000372751 ENSP00000372751 ENSP00000372751 ENSP00000448089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]