SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373077 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373077
Domain Number 1 Region: 73-146
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000987
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373077   Gene: ENSG00000206488   Transcript: ENST00000383583
Sequence length 333
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:30616381:30634174:1 gene:ENSG00000206488 transcript:ENST00000383583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNL
SAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLC
ILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQV
NNFVIFEGFFAHQHRPPAPSLRATRHSRAAAVDPTPAAPARKLPPKRAEGDIKPYSSSDR
EFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERGPLRPFVPEQELLRSLRLCPP
HPTARLLLAADPGGSPAQRRRTSSLPRSEESRY
Download sequence
Identical sequences A0A2I3HLC2
ENSP00000332374 ENSP00000373077 ENSP00000394357 ENSP00000399452 ENSP00000399509 ENSP00000405036 ENSP00000406421 NP_079185.2.87134 NP_079185.2.92137 XP_003272086.1.23891 XP_003807408.2.60992 9606.ENSP00000332374 ENSP00000332374 ENSP00000373077 ENSP00000394357 ENSP00000399452 ENSP00000399509 ENSP00000405036 ENSP00000406421 gi|186910323|ref|NP_079185.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]