SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373108 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373108
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.57e-17
Family Transcriptional factor domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSP00000373108
Domain Number - Region: 13-44
Classification Level Classification E-value
Superfamily RING/U-box 0.0166
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373108   Gene: ENSG00000206502   Transcript: ENST00000383613
Sequence length 126
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:30050846:30054477:1 gene:ENSG00000206502 transcript:ENST00000383613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS
Download sequence
Identical sequences K7AXJ1 Q1XHV8 Q2L6J2 Q9P1U0
9598.ENSPTRP00000030553 9606.ENSP00000331111 9606.ENSP00000383503 9606.ENSP00000397636 9606.ENSP00000405636 9606.ENSP00000410530 9606.ENSP00000410954 9606.ENSP00000414110 9606.ENSP00000416599 ENSP00000331111 ENSP00000352333 ENSP00000365978 ENSP00000365981 ENSP00000373108 ENSP00000383500 ENSP00000383501 ENSP00000383503 ENSP00000387914 ENSP00000391809 ENSP00000393236 ENSP00000394779 ENSP00000395065 ENSP00000395397 ENSP00000396661 ENSP00000396922 ENSP00000397636 ENSP00000399302 ENSP00000399966 ENSP00000402198 ENSP00000405264 ENSP00000405636 ENSP00000407364 ENSP00000407715 ENSP00000410127 ENSP00000410530 ENSP00000410954 ENSP00000412369 ENSP00000413265 ENSP00000414110 ENSP00000414720 ENSP00000416599 gi|25777707|ref|NP_740753.1| gi|7657709|ref|NP_055411.1| GO.40248 ENSP00000331111 ENSP00000352333 ENSP00000365978 ENSP00000365981 ENSP00000373108 ENSP00000383500 ENSP00000383501 ENSP00000383503 ENSP00000387914 ENSP00000391809 ENSP00000393236 ENSP00000394779 ENSP00000395065 ENSP00000395397 ENSP00000396661 ENSP00000396922 ENSP00000397636 ENSP00000399302 ENSP00000399966 ENSP00000402198 ENSP00000405264 ENSP00000405636 ENSP00000407364 ENSP00000407715 ENSP00000410127 ENSP00000410530 ENSP00000410954 ENSP00000412369 ENSP00000413265 ENSP00000414110 ENSP00000414720 ENSP00000416599 ENSPTRP00000030553 ENSPTRP00000030553 NP_001065276.1.37143 NP_001265714.1.87134 NP_001265714.1.92137 NP_001265715.1.87134 NP_001265715.1.92137 NP_055411.1.87134 NP_055411.1.92137 NP_740753.1.87134 NP_740753.1.92137 XP_003829787.1.60992 XP_008953346.1.60992 XP_008953347.1.60992 XP_008953348.1.60992 XP_008953349.1.60992 XP_009449130.1.37143 XP_009449131.1.37143 XP_016810193.1.37143 ENSP00000331111 ENSP00000373108 ENSP00000387914 ENSP00000391809 ENSP00000393236 ENSP00000394779 ENSP00000395065 ENSP00000396661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]