SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373299 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373299
Domain Number 1 Region: 34-178
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.01e-29
Family rRNA adenine dimethylase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373299   Gene: ENSG00000206562   Transcript: ENST00000383789
Sequence length 240
Comment pep:putative chromosome:GRCh38:3:15414374:15427532:-1 gene:ENSG00000206562 transcript:ENST00000383789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDR
HWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVK
QNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKCHG
CSSELRQPWDKDDFAVTWDPWSPAIRVLLCHSGWSAVAWTWLTAASTSWAQAVLPPQPLK
Download sequence
Identical sequences XP_005264927.1.92137 ENSP00000373299 ENSP00000373299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]