SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373506 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373506
Domain Number 1 Region: 60-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.64e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 417-544
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.12e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000216
Further Details:      
 
Weak hits

Sequence:  ENSP00000373506
Domain Number - Region: 4-50
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00671
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373506   Gene: ENSG00000198431   Transcript: ENST00000388854
Sequence length 548
Comment pep:known chromosome:GRCh38:12:104286682:104350305:1 gene:ENSG00000198431 transcript:ENST00000388854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKS
YDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLM
HQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENA
YGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCP
GKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQ
FVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKIN
EKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENV
PTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTK
DNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGA
SILQAGCG
Download sequence
Identical sequences A0A087WSW9
ENSP00000373506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]