SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373854 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373854
Domain Number 1 Region: 18-124,312-616
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.15e-66
Family Integrin alpha N-terminal domain 0.0000392
Further Details:      
 
Domain Number 2 Region: 144-334
Classification Level Classification E-value
Superfamily vWA-like 3.89e-48
Family Integrin A (or I) domain 0.000000829
Further Details:      
 
Domain Number 3 Region: 616-769
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-30
Family Integrin domains 0.0039
Further Details:      
 
Domain Number 4 Region: 771-916
Classification Level Classification E-value
Superfamily Integrin domains 3.03e-29
Family Integrin domains 0.006
Further Details:      
 
Domain Number 5 Region: 948-1088
Classification Level Classification E-value
Superfamily Integrin domains 0.000000204
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373854   Gene: ENSG00000156886   Transcript: ENST00000389202
Sequence length 1161
Comment pep:known chromosome:GRCh38:16:31393312:31426505:1 gene:ENSG00000156886 transcript:ENST00000389202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQ
TGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLLACGPTLHRVCGENSYS
KGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQF
EGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQSLVDPIVQLKGLTFTATGILTVVTQLFH
HKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGIIRYAIGVGHAFQGPTARQEL
NTISSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEMSQEGFSTALT
MDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLV
LGAPRYQHTGKAVIFTQVSRQWRKKAEVTGTQIGSYFGASLCSVDVDSDGSTDLILIGAP
HYYEQTRGGQVSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAALTVLGDVNEDKLIDVAI
GAPGEQENRGAVYLFHGASESGISPSHSQRIASSQLSPRLQYFGQALSGGQDLTQDGLMD
LAVGARGQVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEEKPSALEAGDATVCLTIQKS
SLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCV
EDVVSPIILHLNFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQDGLCEGDLGV
TLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQSA
LRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSE
NNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQR
DLAISINFWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIA
DCLQFRCDVPSFSVQEELDFTLKGNLSFGWVRETLQKKVLVVSVAEITFDTSVYSQLPGQ
EAFMRAQMEMVLEEDEVYNAIPIIMGSSVGALLLLALITATLYKLGFFKRHYKEMLEDKP
EDTATFSGDDFSCVAPNVPLS
Download sequence
Identical sequences Q13349
ENSP00000373854 gi|62548866|ref|NP_005344.2| ENSP00000373854 ENSP00000373854 9606.ENSP00000373854 NP_005344.2.87134 NP_005344.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]