SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374227
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.3e-23
Family Myeloperoxidase-like 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374227   Gene: ENSG00000167419   Transcript: ENST00000389576
Sequence length 117
Comment pep:known chromosome:GRCh38:17:58252182:58268518:1 gene:ENSG00000167419 transcript:ENST00000389576 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
FPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINALTSFLDASFVYSSEPSLASRL
RNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTTARVPCFLAGKETEAQKC
Download sequence
Identical sequences H0Y3I2
ENSP00000374227 ENSP00000374227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]