SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374333 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374333
Domain Number 1 Region: 161-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.64e-116
Family PDEase 0.0000000769
Further Details:      
 
Domain Number 2 Region: 27-140
Classification Level Classification E-value
Superfamily GAF domain-like 1.31e-33
Family GAF domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374333   Gene: ENSG00000128655   Transcript: ENST00000389683
Sequence length 489
Comment pep:known chromosome:GRCh38:2:177629246:177888738:-1 gene:ENSG00000128655 transcript:ENST00000389683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISDAYQDPRFDAEADQI
SGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMY
DQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDDIHFDDFSLDVDAMI
TAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQLMFAMLTTAG
FQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTSATLEHHHFNHAVMI
LQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFELVSKGEYDWNIKNHR
DIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERLELKLTPSAIFDRNRKDE
LPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQKRLLASTASSSPAS
VMVAKEDRN
Download sequence
Identical sequences NP_001070664.1.87134 NP_001070664.1.92137 XP_008966751.1.60992 ENSP00000374333 ENSP00000374333 gi|116536083|ref|NP_001070664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]