SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375661 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375661
Domain Number 1 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 492-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 170-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 133-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000146
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375661   Gene: ENSG00000198538   Transcript: ENST00000391783
Sequence length 546
Comment pep:putative chromosome:GRCh38:19:52800048:52821669:-1 gene:ENSG00000198538 transcript:ENST00000391783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTFFSTGQGNTEAFHTGTLQRQASHHIGDFCFQKIEKDIHGFQFQWKEDETNDHAAPM
TEIKELTGSTGQHDQRHAGNKHIKDQLGLSFHSHLPELHIFQPEGKIGNQVEKSINNASS
VSTSQRICCRPKTHISNKYGNNSLHSSLLTQKRNVHMREKSFQCIESGKSFNCSSLLKKH
QITHLEEKQCKCDVYGKVFNQKRYLACHRRSHIDEKPYKCNECGKIFGHNTSLFLHKALH
TADKPYECEECDKVFSRKSHLETHKIIYTGGKPYKCKVCDKAFTCNSYLAKHTIIHTGEK
PYKCNECGKVFNRLSTLARHRRLHTGEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKC
KVCDKAFAYNSYLAKHSIIHTGEKPYKCNECGKVFNQQSTLARHHRLHTAEKPYKCEECD
KVFRCKSHLERHRRIHTGEKPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFS
TKANLACHHKLHTAEKPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKVCDKAFRRDSH
LAQHQR
Download sequence
Identical sequences C9K0H3
ENSP00000375661 ENSP00000375661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]