SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000375942 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375942
Domain Number 1 Region: 249-333
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.87e-54
Family TATA-box binding protein (TBP), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 164-243
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.77e-53
Family TATA-box binding protein (TBP), C-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375942   Gene: ENSG00000112592   Transcript: ENST00000392092
Sequence length 339
Comment pep:known chromosome:GRCh38:6:170554333:170572869:1 gene:ENSG00000112592 transcript:ENST00000392092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQ
LFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDL
KTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
Download sequence
Identical sequences P20226
ENSP00000230354 ENSP00000375942 ENSP00000375942 5fur_A 5iy6_P 5iy7_P 5iy8_P 5iy9_P 5iya_P 5iyb_P 5iyc_P 5iyd_P 9606.ENSP00000230354 ENSP00000230354 ENSP00000375942 gi|4507379|ref|NP_003185.1| NP_003185.1.87134 NP_003185.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]