SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376474 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376474
Domain Number 1 Region: 14-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.7e-17
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376474   Gene: ENSG00000108946   Transcript: ENST00000392710
Sequence length 124
Comment pep:known chromosome:GRCh38:17:68512450:68532759:1 gene:ENSG00000108946 transcript:ENST00000392710 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERRRQN
RFRICRKQALVQTQGRMRFLLLHPTQWLKVGGDEVLSALRSTRRKMRHPMLERLYQKITR
QWPL
Download sequence
Identical sequences X6RAV4
ENSP00000376474 ENSP00000376474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]