SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376771 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376771
Domain Number 1 Region: 315-542
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.34e-79
Family CAT-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 91-186
Classification Level Classification E-value
Superfamily Single hybrid motif 8.64e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000295
Further Details:      
 
Domain Number 3 Region: 244-289
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000000249
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376771   Gene: ENSG00000150768   Transcript: ENST00000393051
Sequence length 542
Comment pep:novel chromosome:GRCh38:11:112025440:112064390:1 gene:ENSG00000150768 transcript:ENST00000393051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVAAVPPTPQPLAPTPSAPCP
ATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVV
PPTGPGMAPVPTGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELN
KILEGRSKISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPI
VFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQA
CILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITM
LL
Download sequence
Identical sequences E9PEJ4
ENSP00000376771 ENSP00000376771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]