SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376983 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376983
Domain Number 1 Region: 16-45,161-296,392-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000605
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 
Weak hits

Sequence:  ENSP00000376983
Domain Number - Region: 287-411
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.059
Family Alcohol dehydrogenase-like, C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376983   Gene: ENSG00000140961   Transcript: ENST00000393306
Sequence length 477
Comment pep:known chromosome:GRCh38:16:83953222:83966332:1 gene:ENSG00000140961 transcript:ENST00000393306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP
Download sequence
Identical sequences ENSP00000355374 ENSP00000376983 ENSP00000355374 ENSP00000376983 GO.79443 NP_892026.1.87134 NP_892026.1.92137 gi|33695099|ref|NP_892025.1| gi|33695101|ref|NP_892026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]