SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377008 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377008
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 49-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-20
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 5 Region: 437-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 588-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 394-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-17
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 187-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000126
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 10 Region: 492-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000124
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377008   Gene: ENSG00000197857   Transcript: ENST00000393337
Sequence length 637
Comment pep:known chromosome:GRCh38:19:12247643:12294794:-1 gene:ENSG00000197857 transcript:ENST00000393337 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVN
FTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRCDVVERFG
KSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSVNGEVIMGHSSLNCYIRVDTGHKHRE
CHEYAEKSYTHKQCGKGLSYRHSFQTCERPHTGKKPYDCKECGKTFSSPGNLRRHMVVKG
GDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPVYSSYLRHEKIHTGEKP
YECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERIHTGEKPYTCK
QCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGK
LLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRT
SSSLRKHETTHTGEQPYKCKCGKAFSDLFSFQSHETTHSEEEPYECKECGKAFSSFKYFC
RHERTHSEEKSYECQICGKAFSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHER
THTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYE
Download sequence
Identical sequences ENSP00000377008 ENSP00000377008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]