SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377305 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377305
Domain Number 1 Region: 46-82
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000562
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377305   Gene: ENSG00000198948   Transcript: ENST00000393702
Sequence length 102
Comment pep:putative chromosome:GRCh38:4:170004991:170027210:-1 gene:ENSG00000198948 transcript:ENST00000393702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKE
GNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGRL
Download sequence
Identical sequences A0A2J8MQT2 A0A2J8R317
ENSP00000377305 ENSP00000422571 ENSMMUP00000034539 ENSP00000377305 ENSP00000422571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]